PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf04418g04003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 694aa    MW: 75841.4 Da    PI: 6.9467
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf04418g04003.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox291.9e-093934301954
                               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                               Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Niben101Scf04418g04003.1 393 FEHflHPYPKDSDKMMLAKQTGLTRSQVSNWFINARVR 430
                               554459******************************88 PP

2BELL112.13.1e-36257328172
                      BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                               erqe+q+kkakL+++l+eV +rY++y++q+q vis  e++ag+gsak Yt+lAl++iS++FrcLkdai++qi
  Niben101Scf04418g04003.1 257 ERQEIQMKKAKLVNMLDEVAQRYRHYHQQMQSVISWLEQAAGIGSAKTYTALALQTISKQFRCLKDAITGQI 328
                               79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.7E-55177326IPR006563POX domain
PfamPF075265.2E-46187325IPR006563POX domain
PROSITE profilePS5007112.147371434IPR001356Homeobox domain
CDDcd000864.43E-12374435No hitNo description
SMARTSM003899.7E-10374438IPR001356Homeobox domain
SuperFamilySSF466895.99E-17375440IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-28377440IPR009057Homeodomain-like
PfamPF059203.7E-18391430IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 694 aa     Download sequence    Send to blast
MAAYFHGNSE IKGGNDGLQT LILMNPAGYV GFSETQHHQP PAGGSNLVFF NSNPPGNSLS  60
LPHAPPSSQQ QFVGIPLATS AFTAPSSSQD GTTTPTVHSH HDISALHGFL ARSHEYGFYN  120
PSNDITEVRE VTRSQQQGLS LNLSSQQPGF GNFRPEREEL MTTVSPTAGG GSSSSASATQ  180
SVPLCPKYLK AAQELLDEVV NVGKAVKTSR TGEDVSDAQK SKNNGESSGN TATAAAAAQE  240
GGESNSKRDG AELSTAERQE IQMKKAKLVN MLDEVAQRYR HYHQQMQSVI SWLEQAAGIG  300
SAKTYTALAL QTISKQFRCL KDAITGQIRS ASKTLGEEDN IGGKIEGSRL KFVDNQIRQQ  360
RALQQLGMIQ HNAWRPQRGL PERAVSVLRA WLFEHFLHPY PKDSDKMMLA KQTGLTRSQV  420
SNWFINARVR LWKPMVEEMY LEEIKEQEQN GSDLEKTSKL LEQNEDSTSR SIPPQERSPR  480
SDSQNKSFLS KQDNNLENLN PASTIPISNT TSISPTVLSI RNNTGIDIGQ GSPKKLRSNE  540
MLHSPNTVPS INMDVKPNEE QMLIKFGDDR QNRDGFSLMG GPTNFMGGFG SYPIGEIGRF  600
STEQFSAPYS TSGTVSLTLG LPHSENLSMS ATHHSFLPIP TQSIQMGRGV EIGEANEFGS  660
LNTPTSAHST SVYENFNIQN RKRFAAPLLP DFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-16380438563Homeobox protein Meis2
3k2a_B2e-16380438563Homeobox protein Meis2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009787672.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_009787673.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_009787674.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_016480177.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_016480178.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_016480179.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ561e-165BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLM1BX380.0M1BX38_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000549450.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14782467
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-145BEL1-like homeodomain 1